General description
The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein. (provided by RefSeq)
Immunogen
PRKCDBP (NP_659477, 161 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA
Physical form
Solution in phosphate buffered saline, pH 7.4
- UPC:
- 51201703
- Condition:
- New
- HazmatClass:
- No
- MPN:
- SAB1408822-100UG
- Temperature Control Device:
- Yes
akash.verma@cenmed.com
(732) 447-1115





