General description
SLC7A11 is a member of a heteromeric Na(+)-independent anionic amino acid transport system highly specific for cystine and glutamate. In this system, designated system Xc(-), the anionic form of cystine is transported in exchange for glutamate.
Immunogen
Synthetic peptide directed towards the middle region of human SLC7A11
Sequence
Synthetic peptide located within the following region: KGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEK
Physical form
Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41106509
- Condition:
- New
- HazmatClass:
- No
- MPN:
- SAB2109044-100UL
- Temperature Control Device:
- Yes
akash.verma@cenmed.com
(732) 447-1115





