ANTI-SIRT1 (C005B-098547)

General description

Rabbit polyclonal anti-SIRT1 antibody reacts with chicken, human, mouse, rat, canine, and pig sirtuin-1 enzymes.

Sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), a member of the NAD⁽⁺⁾-dependent protein deacetylase SIRT family, is involved in the regulation of nuclear transcription of genes involve in energy metabolism. SIRT1 provides a link between cellular energy status sensing (NAD⁽⁺⁾ status) and the regulation of energy homoeostasis. SIRT1 is involved in the regulation of metabolism, cell differentiation and senescence, stress response, and cancer.

Immunogen

Synthetic peptide directed towards the N terminal region of human SIRT1

Application

Rabbit Anti-SIRT1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Rabbit polyclonal anti-SIRT1 antibody is used to tag sirtuin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of sirtuin-1 in NAD⁽⁺⁾ status-dependent energy homeostasis at the level of nuclear transcription control and protein deacetylation.

Biochem/physiol Actions

SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;

Sequence

Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source: rabbit. Quality Level: 100. conjugate: unconjugated. antibody form: affinity isolated antibody. antibody product type: primary antibodies. clone: polyclonal. form: buffered aqueous solution. mol wt: 82 . kDa. species reactivity: rabbit, horse, guinea pig, rat, human, bovine, dog, mouse. concentration: 0.5 mg - 1 mg/mL. technique(s): western blot: suitable. NCBI accession no.: NP_036370. UniProt accession no.: Q96EB6 . shipped in: wet ice. storage temp.: −. 20°C. target post-translational modification: unmodified. Gene Information: human ... SIRT1(23411). Storage Class Code: 10 - Combustible liquids. WGK: WGK 3. Flash Point(F): Not applicable. Flash Point(C): Not applicable.