General description
The protein encoded by this gene is a serine/threonine protein kinase that interacts with protein kinase C-delta. The encoded protein can also activate NFkappaB and is required for keratinocyte differentiation. This kinase undergoes autophosphorylation. (provided by RefSeq)
Immunogen
RIPK4 (NP_065690, 675 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADVIDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKFQGGHGPAATLLRRSKT
Physical form
Solution in phosphate buffered saline, pH 7.4
- UPC:
- 51201703
- Condition:
- New
- HazmatClass:
- No
- MPN:
- SAB1412553-100UG
- Temperature Control Device:
- Yes
akash.verma@cenmed.com
(732) 447-1115





