ANTI-OPTN (C005B-201946)

General description

Optineurin (OPTN) is a cytoplasmic protein that regulates intraocular pressure in the eye, Golgi synthesis and exocytosis. This protein also modulates the IFNβ response to infections caused by RNA viruses. Mutations in the OPTN gene have been associated with inherited adult-onset open-angle glaucoma . Anti-OPTN antibody is specific for OPTN in humans.

Immunogen

Optineurin recombinant protein epitope signature tag (PrEST)

Application

Anti-OPTN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using protein array and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-OPTN antibody is also suitable for use in indirect immunofluorescence.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85212.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

biological source: rabbit. Quality Level: 100. conjugate: unconjugated. antibody form: affinity isolated antibody. antibody product type: primary antibodies. clone: polyclonal. product line: Prestige Antibodies^®. Powered by Atlas Antibodies. form: buffered aqueous glycerol solution. species reactivity: human. packaging: antibody small pack of 25 . μ. L. enhanced validation: orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation. technique(s): immunoblotting: 0.04-0.4 . μ. g/mL, immunofluorescence: 0.25-2 . μ. g/mL, immunohistochemistry: 1:1000-1:2500. immunogen sequence: LGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKG. UniProt accession no.: Q96CV9. shipped in: wet ice. storage temp.: −. 20°C. target post-translational modification: unmodified. Gene Information: human ... OPTN(10133). Storage Class Code: 10 - Combustible liquids. WGK: WGK 1. Flash Point(F): Not applicable. Flash Point(C): Not applicable. Personal Protective Equipment: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US).