Immunogen
Synthetic peptide directed towards the N terminal region of human ITGB1BP2
Biochem/physiol Actions
ITGB1BP2 may play a role during maturation and/or organization of muscles cells.
Sequence
Synthetic peptide located within the following region: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
biological source: rabbit. Quality Level: 100. conjugate: unconjugated. antibody form: IgG fraction of antiserum. antibody product type: primary antibodies. clone: polyclonal. form: buffered aqueous solution. mol wt: 38 . kDa. species reactivity: rat, mouse, human, rabbit. concentration: 0.5 mg - 1 mg/mL. technique(s): immunohistochemistry: suitable, western blot: suitable. NCBI accession no.: NP_036410. UniProt accession no.: Q9UKP3. shipped in: wet ice. storage temp.: −. 20°C. target post-translational modification: unmodified. Gene Information: human ... ITGB1BP2(26548). Storage Class Code: 10 - Combustible liquids. WGK: WGK 3. Flash Point(F): Not applicable. Flash Point(C): Not applicable.- UPC:
- 51201647
- Condition:
- New
- HazmatClass:
- No
- MPN:
- AV42358-100UL
akash.verma@cenmed.com
(732) 447-1115





