Computed tomography CT/CAT power conditioners

Immunotag™ CTSE Antibody-Alexa Fluor® 488*

Immunotag™ Catenin-beta Antibody-Alexa Fluor® 555*

Immunotag™ Catenin-beta Antibody-Alexa Fluor® 555*

PSMA Val Kit PAB MMAE is a novel small molecule PSMA targeting complex based on MMAE, used for chemotherapy of prostate cancer. Powder -20°C 3 years，4°C 2 years；In solvent -80°C 6 months，-20°C 1 month

S-Maruoka CAT P-NB

Cimarec7x7 HPS AU/CN230V

1200C CNTRL SERV 3216P W/COM

Vios iDx 165 230V CU IR CL

VIOS iDx 165 230V CU IR

SYR,1750N,22 PT 3,CTC-S<br>Image(s) are representative of the product group and not necessarily the individual product.

MltfugX4R Pro 230V 50/60Hz CTS

Immunogen The immunogen for anti-CTPS2 antibody: synthetic peptide derected towards the N terminal of human CTPS2 Sequence Synthetic peptide located within the following region: AKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSS Physical form