Electrophoresis premade buffers or solutions

1X ASSAY/SAMPLE DILUENT BUFFER C

ASSAY BUFFER (12 ML)

General description The swab in the vial with phosphate buffer contains a neutralizing agent to counteract adverse effects of residual chlorine or quaternary ammonium compounds that may be present on surfaces after sanitization. The swab in the

General description Tris-Borate-EDTA (TBE) buffer is a commonly used running buffer for nucleic gel electrophoresis with a pH range from 8.1-8.

Immunogen Synthetic peptide directed towards the N terminal of human PDE4B Sequence Synthetic peptide located within the following region: LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG Physical form Purified antibody supplied in 1x PBS

Application Tris-Borate-EDTA buffer is suitable for use in gel electrophoresis. It may be employed for the following studies: As buffer system for the evaluation of molecular weights of glycoproteins of ovalbumin, avidin and fetuin by sodium

Application Tris-Borate-EDTA buffer is suitable for use in gel electrophoresis. It may be employed for the following studies: As buffer system for the evaluation of molecular weights of glycoproteins of ovalbumin, avidin and fetuin by sodium

General description TBE (Tris/Borate/EDTA) Buffer is commonly used in nucleic acid electrophoresis. This solution is effective under slightly basic conditions, which keeps DNA deprotonated, water-soluble, and protected from degradation.

General description TBE (Tris/Borate/EDTA) Buffer is commonly used in nucleic acid electrophoresis. This solution is effective under slightly basic conditions, which keeps DNA deprotonated, water-soluble, and protected from degradation.

Application Ready for use in gel electrophoresis after dilution to working concentrations. Tris-Borate-EDTA buffer has been used in the electrophoresis of the plasmid extracted from activated sludge.

Application Ready for use in gel electrophoresis after dilution to working concentrations. TBE running buffer is the most commonly used buffer for DNA and RNA polyacrylamide gel electrophoresis.

Application TBE running buffer is the most commonly used buffer for DNA and RNA polyacrylamide gel electrophoresis. TBE is used with non-denaturing or denaturing (7 M urea) gels.